PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007540P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 369aa    MW: 41348.5 Da    PI: 7.3491
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007540P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32243298156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  MELO3C007540P1 243 KQRRCWSPELHRRFVDALHRLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 298
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.192240300IPR017930Myb domain
SuperFamilySSF466891.84E-18240301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-29242302IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-26243298IPR006447Myb domain, plants
PfamPF002492.3E-8245296IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MELSLDLSLD HSPKTIPQIL HELSSISDSF TKRSKLDDYV KRLEDEMRKI DAFKRELPLC  60
VLLLQDAILR LKDEVLQFKE QPVIEEFIPS KGISDQADEE NVKRKTRKWL SSAQLWSTNF  120
NFVDEEIANP KSNMNLDGDE DDRSVPQTPI ENWNCAKRRR AFELFKDQNN FVKRATNEDV  180
AFSEVPKLTL MTPISDPFPV NLTVKNGGNG GRNGRAAVSG LSSPAGQMKG QAKLSQQQQT  240
IRKQRRCWSP ELHRRFVDAL HRLGGSQVAT PKQIRELMQV DGLTNDEVKS HLQKYRLHVR  300
KLSPAEGSSG ENELKTSVTH AGSPDGPLHG GGSGKALSTT EGESMEVEED AKSDGHSWKG  360
RIQKHGDM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440244.10.0PREDICTED: uncharacterized protein LOC103484758
TrEMBLA0A0A0KIA90.0A0A0A0KIA9_CUCSA; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-61G2-like family protein